I am new to shell scripting and I am trying to sequentially number the headers in a fasta file. The sequences in my fasta file look like this:
>Rodentia sp.
MALWILLPLLALLILWGPDPAQAFVNQHLCGSHLVEALYILVCGERGFFYTPMSRREVED
PQVGQVELGAGPGAGSEQTLALEVARQARIVQQCTSGICSLYQENYCN
>Ovis aries
MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN
I want to use awk in my shell script so that the headers are sequentially numbered, by inserting a number starting from 1 to n (where n is the number of sequences) after the ">", so that the sequences look like this:
> 1 Rodentia sp.
MALWILLPLLALLILWGPDPAQAFVNQHLCGSHLVEALYILVCGERGFFYTPMSRREVED
PQVGQVELGAGPGAGSEQTLALEVARQARIVQQCTSGICSLYQENYCN
> 2 Ovis aries
MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN
I tried using the sub function in awk, to do this, replacing every instance of ">" with "> [a number]".
awk '/>/{sub(">", "> ++i ")}1' file
However, I don't understand how to increment variables using the sub function in awk. I would like to know if there is a way to do this using the sub function. I understand how sub works, but I don't know how to declare the variable to be incremented properly.
I declared i to be 1 at the beginning of my shell script:
i=1
However, the output I get from the sub function is:
> ++$i Rodentia sp.
> ++$i Ovis aries
How can a declare a variable properly so that I can use the awk sub function to number the headers?